General Information

  • ID:  hor000674
  • Uniprot ID:  Q9N0V5
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Equus caballus (Horse)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAP
  • Length:  32(84-115)
  • Propeptide:  MGFWKFSPFLPLSILVLYQVGIIQAAPFRSALESLPDPAVLPEEESRLLLAALVKDYVQMKVRALEQEQETGGASLDSPRAKRCSNLSTCVLGTYTQDLNKFHTFPQTAIGVGAPGKKRVMARGLERDHGPHIGTSQDAY
  • Signal peptide:  MGFWKFSPFLPLSILVLYQVGIIQA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood
  • Mechanism:  Promot the incorporation of those ions in the bones.
  • Cross BBB:  NA
  • Target:  CALCR
  • Target Unid:   F6YHG4
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45664
  • Structure ID:  AF-Q9N0V5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000674_AF2.pdbhor000674_ESM.pdb

Physical Information

Mass: 393796 Formula: C149H231N39O47S2
Absent amino acids: EMRW Common amino acids: T
pI: 7.25 Basic residues: 2
Polar residues: 15 Hydrophobic residues: 10
Hydrophobicity: 9.69 Boman Index: -2036
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 73.13
Instability Index: 2733.75 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  12581884
  • Title:  Molecular Cloning and Expression of Equine Calcitonin, Calcitonin Gene-Related peptide-I, and Calcitonin Gene-Related peptide-II